Antibodies

View as table Download

Anti-Human Leptin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Leptin

Rabbit Polyclonal Anti-LEP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS

Biotinylated Anti-Human Leptin Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Leptin

Leptin (LEP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 7-37 amino acids from the N-terminal region of Human Leptin.

Rabbit anti-LEP Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LEP

Rabbit Polyclonal Anti-LEP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEP antibody: synthetic peptide directed towards the middle region of human LEP. Synthetic peptide located within the following region: LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM

Anti-Murine Leptin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine Leptin

Leptin (LEP) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-Leptin antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant rat Leptin

Biotinylated Anti-Murine Leptin Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine Leptin

Anti-LEP Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-LEP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-LEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

LEP Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse LEP

LEP rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

LEP Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-167 of human LEP (NP_000221.1).
Modifications Unmodified