Rabbit Polyclonal ATG9A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG9A antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ATG9A. |
Rabbit Polyclonal ATG9A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATG9A antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ATG9A. |
Rabbit polyclonal ATG9A Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ATG9A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 717-746 amino acids from the C-terminal region of human ATG9A. |
Rabbit Polyclonal ATG9A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the C-terminus of human ATG9A (between residues 750-839). [Swiss-Prot# Q7Z3C6]. |
Rabbit Polyclonal Anti-ATG9A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ATG9A Antibody: synthetic peptide directed towards the middle region of human ATG9A. Synthetic peptide located within the following region: VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV |
Rabbit Polyclonal Anti-ATG9A Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATG9A |
ATG9A Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ATG9A |
ATG9A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATG9A |
ATG9A Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human ATG9A (NP_076990.4). |
Modifications | Unmodified |
ATG9A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human ATG9A (NP_076990.4). |
Modifications | Unmodified |