Antibodies

View as table Download

Rabbit Polyclonal MBD3 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD3 antibody: human MBD3 (Methyl-CpG-binding domain protein 3), using three different KLH-conjugated synthetic peptides.

Rabbit Polyclonal Anti-MBD3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD3 antibody: synthetic peptide directed towards the N terminal of human MBD3. Synthetic peptide located within the following region: SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN

Rabbit Polyclonal Anti-MBD3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD3 Antibody: A synthesized peptide derived from human MBD3

Rabbit polyclonal anti-MBD3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MBD3.

MBD3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human MBD3 (NP_001268383.1).
Modifications Unmodified

MDB3 Rabbit polyclonal Antibody

Applications FC, IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human MBD3