Antibodies

Jump to Filters
View as table Download
SPI1 Rabbit Polyclonal Antibody
TA372904

USD 380.00

4 Weeks

SPI1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SPI1
SPI1 Rabbit Polyclonal Antibody
TA324571

USD 450.00

5 Days

Rabbit polyclonal SPI1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SPI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the C-terminal region of human SPI1.
SPI1 Rabbit Polyclonal Antibody
TA326225

USD 345.00

In Stock

Rabbit polyclonal SPI1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human SPI1.
SPI1 Goat Polyclonal Antibody
TA303347

USD 375.00

5 Days

Goat Polyclonal Antibody against SPI1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DLYQRQTHEYY, from the internal region of the protein sequence according to NP_001074016.1; NP_003111.2.
SPI1 Rabbit Polyclonal Antibody
TA329273

USD 375.00

5 Days

Rabbit Polyclonal anti-SPI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPI1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPI1. Synthetic peptide located within the following region: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH
SPI1 Rabbit Polyclonal Antibody
TA329274

USD 375.00

5 Days

Rabbit Polyclonal anti-SPI1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPI1 antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: HPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGL
SPI1 Rabbit Polyclonal Antibody
TA335785

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPI1 Antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER
Spi1 Rabbit Polyclonal Antibody
TA355929

USD 300.00

5 Days

SFPI1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse SFPI1
SPI1 Rabbit Polyclonal Antibody
TA381931

USD 220.00

3 Weeks

SPI1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SPI1.
Modifications Unmodified