Antibodies

Jump to Filters
View as table Download
MELK Rabbit Polyclonal Antibody
AP20443PU-N

USD 407.00

2 Weeks

MELK rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
MELK Goat Polyclonal Antibody
TA302675

USD 375.00

5 Days

Goat Polyclonal Antibody against MELK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KRLVEDILSSCKV, from the C Terminus of the protein sequence according to NP_055606.1.
Melk Rabbit Polyclonal Antibody
TA339318

USD 375.00

5 Days

Rabbit Polyclonal Anti-Melk Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Melk antibody is: synthetic peptide directed towards the N-terminal region of Mouse Melk. Synthetic peptide located within the following region: GFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHIC
MELK Rabbit Polyclonal Antibody
TA339317

USD 375.00

5 Days

Rabbit Polyclonal Anti-MELK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MELK antibody: synthetic peptide directed towards the middle region of human MELK. Synthetic peptide located within the following region: AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK
MELK Rabbit Polyclonal Antibody
TA359464

USD 360.00

5 Days

MELK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MELK
MELK Rabbit Polyclonal Antibody
TA378457

USD 220.00

3 Weeks

MELK Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 412-651 of human MELK (NP_055606.1).
Modifications Unmodified