Rabbit Polyclonal Anti-SLC22A6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC22A6 antibody: synthetic peptide directed towards the N terminal of human SLC22A6. Synthetic peptide located within the following region: AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP |
Rabbit Polyclonal Anti-SLC22A6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC22A6 antibody: synthetic peptide directed towards the C terminal of human SLC22A6. Synthetic peptide located within the following region: ETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQA |
Anti-SLC22A6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 551-563 amino acids of Human solute carrier family 22 (organic anion transporter), member 6 |
Anti-SLC22A6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 551-563 amino acids of Human solute carrier family 22 (organic anion transporter), member 6 |
SLC22A6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC22A6 |
| Modifications | Unmodified |
OAT1 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from human OAT1 Polyclonal |
Germany
Japan
United Kingdom
China
