Antibodies

View as table Download

Rabbit Polyclonal ABCF2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-ABCF2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCF2.

Rabbit Polyclonal Antibody against ABCF2

Applications WB
Reactivities Human, Yeast
Conjugation Unconjugated
Immunogen A fusion protein containing amino acids 1-102 of the ABCF2 protein.

Rabbit Polyclonal Anti-ABCF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCF2 Antibody: synthetic peptide directed towards the N terminal of human ABCF2. Synthetic peptide located within the following region: DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL

Rabbit Polyclonal Anti-ABCF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCF2 Antibody: synthetic peptide directed towards the middle region of human ABCF2. Synthetic peptide located within the following region: YGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETI

Anti-ABCF2 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 396-613 amino acids of human ATP-binding cassette, sub-family F (GCN20), member 2

Anti-ABCF2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 396-613 amino acids of human ATP-binding cassette, sub-family F (GCN20), member 2

ABCF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ABCF2 (NP_005683.2).
Modifications Unmodified

ABCF2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ABCF2 (NP_005683.2).
Modifications Unmodified