ABCF2 Rabbit Polyclonal Antibody

CAT#: TA332055

Rabbit Polyclonal Anti-ABCF2 Antibody

Product Images

WB Suggested Anti-ABCF2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ABCF2 Antibody: synthetic peptide directed towards the N terminal of human ABCF2. Synthetic peptide located within the following region: DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: ATP binding cassette subfamily F member 2
• Database Link:
  NP_005683
  Entrez Gene 114483834 Entrez Gene 10061 Human
  UniProt ID Q9UG63
• Background: This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ATP-binding casette proteins transport various molecules across extra- and intracellular membranes. Alterations in this gene may be involved in cancer progression. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 7. [provided by RefSeq, Jul 2013]
• Synonyms: ABC28; EST133090; HUSSY-18; HUSSY18
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%