Germany
Japan
United Kingdom
China
Rabbit Polyclonal ABCF2 Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit polyclonal anti-ABCF2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCF2. |
Rabbit Polyclonal Anti-ABCF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCF2 Antibody: synthetic peptide directed towards the N terminal of human ABCF2. Synthetic peptide located within the following region: DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL |
Rabbit Polyclonal Anti-ABCF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCF2 Antibody: synthetic peptide directed towards the middle region of human ABCF2. Synthetic peptide located within the following region: YGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETI |
Anti-ABCF2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 396-613 amino acids of human ATP-binding cassette, sub-family F (GCN20), member 2 |
ABCF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ABCF2 (NP_005683.2). |
| Modifications | Unmodified |
ABCF2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ABCF2 (NP_005683.2). |
| Modifications | Unmodified |
ABCF2 mouse monoclonal antibody,clone OTI8F4
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
ABCF2 mouse monoclonal antibody,clone OTI5D5
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Active filters
Target Symbol
- ABCF2