Antibodies

View as table Download

Goat Anti-CLIC1 / NCC27 (aa45-57) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TVDTKRRTETVQK, from the internal region of the protein sequence according to NP_001279.2.

CLIC1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a recombinant human CLIC1 protein.

Rabbit Polyclonal Anti-CLIC1

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RGFTIPEAFRGVHR, corresponding to amino acid residues 195-208 of human CLIC1. Intracellular, C-terminus.

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF

Goat Anti-CLIC1 / NCC27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TEVHTDTNKIEE, from the internal region of the protein sequence according to NP_001279.2.

Rabbit polyclonal anti-CLIC1 antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CLIC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 136-166 amino acids from the Central region of human CLIC1.

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1. Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CLIC1

CLIC1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse CLIC1

CLIC1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-241 of human CLIC1 (NP_001279.2).
Modifications Unmodified

CLIC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-241 of human CLIC1 (NP_001279.2).
Modifications Unmodified