Antibodies

Jump to Filters
View as table Download
Gabrd Rabbit Polyclonal Antibody
TA328816

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-GABA(A) delta Receptor (extracellular)

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HHGARAMNDIGDYVGSN, corresponding to amino acid residues 19-35 of rat GABA(A)d .
GABA A Receptor delta (GABRD) Rabbit Polyclonal Antibody
TA330436

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRD Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
GABA A Receptor delta (GABRD) Rabbit Polyclonal Antibody
AP21176PU-N

USD 370.00

2 Weeks

GABA A Receptor delta (GABRD) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
GABA A Receptor delta (GABRD) Rabbit Polyclonal Antibody
TA330437

USD 310.00

5 Days

Rabbit Polyclonal Anti-GABRD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
GABA A Receptor delta (GABRD) Rabbit Polyclonal Antibody
TA376451

USD 220.00

3 Weeks

GABRD Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 330-430 of human GABRD (NP_000806.2).