Antibodies

View as table Download

GALM rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Mutarotase isolated and purified from Porcine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure.

GALM rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen Mutarotase isolated and purified from Porcine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure.

GALM rabbit polyclonal antibody, Serum

Applications ELISA, IP, WB
Reactivities Porcine
Immunogen Mutarotase [Porcine Kidney].

GALM rabbit polyclonal antibody, Biotin, Purified

Applications ELISA, IP, WB
Reactivities Porcine
Conjugation Biotin
Immunogen Mutarotase from porcine kidney

GALM rabbit polyclonal antibody, HRP, Purified

Applications ELISA, IP, WB
Reactivities Porcine
Conjugation HRP
Immunogen Mutarotase from porcine kidney

GALM rabbit polyclonal antibody, Purified

Applications ELISA, IP, WB
Reactivities Porcine
Immunogen Mutarotase from porcine kidney

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the N terminal of human GALM. Synthetic peptide located within the following region: WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the middle region of human GALM. Synthetic peptide located within the following region: SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK

GALM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GALM

GALM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GALM

GALM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human GALM (NP_620156.1).
Modifications Unmodified