Antibodies

View as table Download

Rabbit Polyclonal antibody to HSPA6 (heat shock 70kDa protein 6 (HSP70B'))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 377 and 628 of HSPA6 (Uniprot ID#P17066)

Rabbit Polyclonal Anti-HSPA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV

HSPA6 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 474-643 of human HSPA6 (NP_002146.2).
Modifications Unmodified

HspA6/A7 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the Internal region of human HSP77/76.