HSPA6 Rabbit Polyclonal Antibody

CAT#: TA335045

Rabbit Polyclonal Anti-HSPA6 Antibody

Product Images

WB Suggested Anti-HSPA6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: heat shock protein family A (Hsp70) member 6
• Database Link:
  NP_002146
  Entrez Gene 3310 Human
  UniProt ID P17066
• Background: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
• Synonyms: heat shock 70kDa protein 6 (HSP70B'); heat shock 70kD protein 6 (HSP70B')
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%

Reference Data

• Protein Pathways: Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Spliceosome