Antibodies

View as table Download

INDOL1 (IDO2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 267-295 amino acids from the C-terminal region of Human IDO2 / INDOL1

Rabbit Polyclonal Anti-IDO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDO2 antibody is: synthetic peptide directed towards the C-terminal region of Human IDO2. Synthetic peptide located within the following region: LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH

Goat Anti-IDO2 / INDOL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDKTLESILHPR, from the C Terminus of the protein sequence according to NP_919270.2.

IDO2 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

IDO2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

IDO 2 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human IDO2. AA range:101-150