Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-Human IL-22 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-22 |
IL22 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human Interleukin-22 (hIL-22). |
IL22 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-22 (hIL-22). |
IL22 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-22 (hIL-22). |
IL22 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human Interleukin-22 (hIL-22). |
Rabbit Polyclonal Anti-IL22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL22 antibody: synthetic peptide directed towards the C terminal of human IL22. Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
IL22 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22 (NP_065386.1). |
| Modifications | Unmodified |
IL-22 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the C-terminal region of human IL22. AA range:121-170 |
Active filters
Target Symbol
- IL22
Clonalities
- Polyclonal