Anti-KCNC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 616-726 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 3 |
Goat Polyclonal Antibody against KCNC3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KPGPPSFLPDLNAN, from the C Terminus of the protein sequence according to NP_004968.2. |
Rabbit polyclonal Anti-KV3.3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide KSPITPGSRGRYSRDRAC, corresponding to? amino acid residues 701-718 of rat Kv3.3 . Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNC3 antibody: synthetic peptide directed towards the middle region of human KCNC3. Synthetic peptide located within the following region: YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM |
Germany
Japan
United Kingdom
China
