Antibodies

Jump to Filters
View as table Download
GAL4 (LGALS4) Rabbit Polyclonal Antibody
TA372595

USD 380.00

4 Weeks

LGALS4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS4
GAL4 (LGALS4) Rabbit Polyclonal Antibody
TA314152

USD 345.00

In Stock

Rabbit polyclonal anti-LEG4 antibody

Applications IHC, WB
Reactivities WB: 1:500~1:1000 IHC: 1:50~1:100 ELISA: 1:20000
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LEG4.
Lgals4 Rabbit Polyclonal Antibody
TA346427

USD 475.00

5 Days

Rabbit Polyclonal Anti-Lgals4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS
GAL4 (LGALS4) Rabbit Polyclonal Antibody
AP20547PU-N

USD 370.00

2 Weeks

GAL4 (LGALS4) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
GAL4 (LGALS4) (N-term) Rabbit Polyclonal Antibody
AP52469PU-N

USD 450.00

2 Weeks

GAL4 (LGALS4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 77-106 amino acids from the N-terminal region of Human Galectin-4
LGALS4 Rabbit Polyclonal Antibody
TA368351

USD 380.00

4 Weeks

LGALS4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS4
GAL4 (LGALS4) Rabbit Polyclonal Antibody
TA378008

USD 220.00

3 Weeks

Galectin 4/LGALS4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Galectin 4/LGALS4 (NP_006140.1).