Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against OLFM1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Olfm1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-100 amino acids from the N-terminal region of human Olfm1. |
Rabbit Polyclonal Antibody against OLFM1 (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Olfm1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 434-463 amino acids from the C-terminal region of human Olfm1. |
Rabbit Polyclonal Anti-OLFM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the N-terminal region of Human OLFM1. Synthetic peptide located within the following region: VLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK |
Rabbit Polyclonal Anti-OLFM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the C-terminal region of Human OLFM1. Synthetic peptide located within the following region: EKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLA |
OLFM1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-220 of human OLFM1 (NP_055094.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- OLFM1
Clonalities
- Polyclonal