Antibodies

Jump to Filters
View as table Download
PCCA Rabbit Polyclonal Antibody
TA332364

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCCA Antibody: synthetic peptide directed towards the N terminal of human PCCA. Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI
PCCA (Center) Rabbit Polyclonal Antibody
AP53192PU-N

USD 450.00

2 Weeks

PCCA (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human PCCA
PCCA Rabbit Polyclonal Antibody
TA379670

USD 220.00

3 Weeks

PCCA Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 449-728 of human PCCA (NP_000273.2).
Modifications Unmodified