Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PDE1B (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 466-495 amino acids from the C-terminal region of human PDE1B |
Anti-PDE1B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 190-536 amino acids of human phosphodiesterase 1B, calmodulin-dependent |
Rabbit Polyclonal Anti-PDE1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE1B antibody: synthetic peptide directed towards the middle region of human PDE1B. Synthetic peptide located within the following region: VKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNL |
PDE1B Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse PDE1B |
Active filters
Target Symbol
- PDE1B
Clonalities
- Polyclonal