Antibodies

Jump to Filters
View as table Download
RALGDS Rabbit Polyclonal Antibody
TA335961

USD 375.00

5 Days

Rabbit Polyclonal Anti-RALGDS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RALGDS Antibody: synthetic peptide directed towards the N terminal of human RALGDS. Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED
RALGDS Rabbit Polyclonal Antibody
TA380691

USD 220.00

3 Weeks

RALGDS Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RALGDS.