TIA1 (189-199) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Chicken, Human, Monkey, Mouse, Rabbit, Rat, Xenopus |
Immunogen | Synthetic peptide from an internal region of human TIA1 |
TIA1 (189-199) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Chicken, Human, Monkey, Mouse, Rabbit, Rat, Xenopus |
Immunogen | Synthetic peptide from an internal region of human TIA1 |
Rabbit Polyclonal Anti-TIA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TIA1 antibody: synthetic peptide directed towards the N terminal of human TIA1. Synthetic peptide located within the following region: MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED |
Rabbit Polyclonal Anti-TIA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TIA1 antibody: synthetic peptide directed towards the C terminal of human TIA1. Synthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ |
Goat Polyclonal Antibody against TIA1
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PKSTYESNTKQ, from the internal region of the protein sequence according to NP_071320.1; NP_071505.1. |
TIA1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
TIA1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
TIA1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human TIA1 (NP_071505.2). |
Modifications | Unmodified |
TIA1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TIA1 (NP_071505.2). |
Modifications | Unmodified |
TIA1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human TIA1 (NP_071505.2). |
Modifications | Unmodified |