Rabbit Polyclonal Anti-Calcineurin A Antibody
Reactivities | Canine, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Human Calcineurin A peptide (AA 364-283) |
Rabbit Polyclonal Anti-Calcineurin A Antibody
Reactivities | Canine, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Human Calcineurin A peptide (AA 364-283) |
Rabbit Polyclonal Anti-PPP3CA
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL |
Carrier-free (BSA/glycerol-free) PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PPP3CA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PPP3CA |
PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |