Goat Polyclonal Antibody against MTR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245. |
Goat Polyclonal Antibody against MTR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245. |
Rabbit Monoclonal antibody against DHFR
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-DHFR Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DHFR |
ALDH1L1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2A6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700395 |
Rabbit polyclonal antibody to MTHFR (5,10-methylenetetrahydrofolate reductase (NADPH))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 248 of MTHFR (Uniprot ID#P42898) |
Anti-DHFR Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-MTR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTR antibody: synthetic peptide directed towards the C terminal of human MTR. Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL |
Rabbit polyclonal MTHFD2 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2. |
Rabbit Polyclonal Anti-MTHFD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD |
Goat Polyclonal Antibody against MTHFR (aa369-383)
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRPKSYIYRTQEWDE, from the internal region of the protein sequence according to NP_005948.3. |
Rabbit Polyclonal Anti-MTHFD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG |
Rabbit Polyclonal Anti-MTHFD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYV |
ALDH1L1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4C11
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700396 |
ALDH1L1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5G8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700396 |
ALDH1L1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI7G6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700395 |
Goat Anti-MTHFD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RGDLNDCFIPCTPK, from the internal region of the protein sequence according to NP_005947.2. |
Rabbit polyclonal antibody to Thymidylate synthetase (thymidylate synthetase)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 313 of Thymidylate synthetase (Uniprot ID#P04818) |
Sheep polyclonal Thymidylate Synthase antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-THYMIDYLATE SYNTHASE was purified from rabbit serum after repeated immunizations with recombinant human Thymidylate Synthase (36 kDa) produced in E.coli. |
Sheep polyclonal Thymidylate Synthase antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This whole sheep serum was prepared by repeated immunizations with recombinant human Thymidylate Synthase (36 kDa) produced in E.coli. |
Rabbit polyclonal Thymidylate Synthase antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with recombinant human Thymidylate Synthase (36 kDa) produced in E.coli. |
Rabbit Polyclonal Anti-MTHFD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE |
Rabbit Polyclonal Anti-MTHFD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the middle region of human MTHFD2. Synthetic peptide located within the following region: VWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVT |
Rabbit Polyclonal Anti-MTHFD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: VILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLN |
ALDH1L1 Capture mouse monoclonal antibody, Luminex validated, clone OTI1H6
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700394 |
Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI7G6 (formerly 7G6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI7G8 (formerly 7G8)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI6A10 (formerly 6A10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI9H4 (formerly 9H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI10F12 (formerly 10F12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody,clone OTI1E12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |