Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RAB3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB3A antibody: synthetic peptide directed towards the C terminal of human RAB3A. Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC |
Carrier-free (BSA/glycerol-free) RAB3A mouse monoclonal antibody,clone OTI2H7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB3A mouse monoclonal antibody,clone OTI6D10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAB3A mouse monoclonal antibody,clone OTI5B9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAB3A mouse monoclonal antibody,clone OTI2H7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAB3A mouse monoclonal antibody,clone OTI2H7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAB3A mouse monoclonal antibody,clone OTI6D10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAB3A mouse monoclonal antibody,clone OTI6D10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAB3A mouse monoclonal antibody,clone OTI5B9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RAB3A mouse monoclonal antibody,clone OTI5B9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RAB3A
Conjugates
- Unconjugated
Families
- Druggable Genome