Antibodies

View as table Download

Rabbit Polyclonal SLAMF1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SLAMF1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human SLAMF1.

Rabbit polyclonal anti-SLAM/CD150 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Amino acids corresponding to 138-153 of human SLAM

Rabbit Polyclonal Anti-SLAMF1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Slamf1 antibody is: synthetic peptide directed towards the middle region of Mouse Slamf1. Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR

Rabbit Polyclonal Anti-SLAMF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SLAMF1

SLAMF1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated