Antibodies

Jump to Filters
View as table Download
CYP46 (CYP46A1) Rabbit Polyclonal Antibody
TA301675

USD 424.00

5 Days

Rabbit Polyclonal Antibody against Cyp-46

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to residues between 200-250 of human Cyp46.
CYP46 (CYP46A1) Rabbit Polyclonal Antibody
TA332027

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP46A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP46A1 Antibody: synthetic peptide directed towards the C terminal of human CYP46A1. Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM
CYP46 (CYP46A1) Rabbit Polyclonal Antibody
TA351117

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYP46A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP46A1