Rabbit polyclonal BCKD antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human BCKD. |
Rabbit polyclonal BCKD antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human BCKD. |
Rabbit Polyclonal Anti-BCKD Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCKD Antibody: A synthesized peptide derived from human BCKD |
Rabbit Polyclonal Antibody against BCKDK (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This BCKDK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-151 amino acids from the Central region of human BCKDK. |
Rabbit Polyclonal Anti-BCKDK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCKDK antibody: synthetic peptide directed towards the N terminal of human BCKDK. Synthetic peptide located within the following region: CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD |
Carrier-free (BSA/glycerol-free) BCKDK mouse monoclonal antibody, clone OTI11C9 (formerly 11C9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BCKDK (BCKDH kinase) mouse monoclonal antibody, clone OTI11C9 (formerly 11C9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BCKDK (BCKDH kinase) mouse monoclonal antibody, clone OTI11C9 (formerly 11C9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |