Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-PLA2G2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLA2G2A Antibody: Peptide with sequence C-SYKFSNSGSRIT, from the internal region of the protein sequence according to NP_000291.1. |
Goat Polyclonal Antibody against LAT1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GAPDYENLQELN, from the C Terminus of the protein sequence according to NP_055202.1; NP_001014987.1; NP_001014989.1; NP_001014988.1. |
Rabbit polyclonal anti-IL-13 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant mouse IL-13 |
Anti-PLA2G2A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-144 amino acids of human phospholipase A2, group IIA (platelets, synovial fluid) |
Rabbit anti-FCER1A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FCER1A |
Rabbit anti-LAT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LAT |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal LAT (Ab-255) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human LAT around the phosphorylation site of tyrosine 255. |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal anti-LAT Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL-13 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IL-13 (E.coli-derived) is used |
Mouse Anti-Human LAT Purified (25 ug)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-FCER1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-205 amino acids of human Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide |
Goat Anti-FCER1A (aa177-189) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TGKVWQLDYESEP, from the internal region of the protein sequence according to NP_001992.1. |
Rabbit Polyclonal Anti-FCER1G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCER1G antibody: synthetic peptide directed towards the N terminal of human FCER1G. Synthetic peptide located within the following region: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV |
Rabbit Polyclonal Anti-PLA2G2E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Mouse Monoclonal Anti-IL-13 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-TNF-alpha Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-TNF-alpha Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti TNF alpha Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) IL13 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PLA2G2A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FCER1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FCER1A |
FCER1A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FCER1A |
Active filters
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Fc epsilon RI signaling pathway