Rabbit Polyclonal Annexin A7 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Annexin A7 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal antibody to Annexin VII (annexin A7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 459 of Annexin VII (Uniprot ID#P20073) |
Rabbit polyclonal ANXA7 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ANXA7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-356 amino acids from the Central region of human ANXA7. |
Rabbit Polyclonal Anti-ANXA7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7. Synthetic peptide located within the following region: MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP |
Rabbit Polyclonal Anti-ANXA7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7. Synthetic peptide located within the following region: GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK |
Anti-ANXA7 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 232 amino acids of Human Annexin A7 |
Anti-ANXA7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 232 amino acids of Human Annexin A7 |
ANXA7 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 237-466 of human ANXA7 (NP_001147.1). |
Modifications | Unmodified |
Annexin VII Rabbit monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |