Annexin VII (ANXA7) Rabbit Polyclonal Antibody
Other products for "ANXA7"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7. Synthetic peptide located within the following region: GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 51 kDa |
Gene Name | annexin A7 |
Database Link | |
Background | Annexin VII is a member ofThe annexin family of calcium-dependent phospholipid binding proteins.The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing inTheir N-terminal domain.The alternative splicing event is tissue specific andThe mRNA containingThe cassette exon is prevalent in brain, heart and skeletal muscle.The transcripts also differ inTheir 3'-non coding regions byThe use of two alternative poly(A) signals. Annexin VII encodes a protein with a molecular weight of approximately 51 kDa with a unique, highly hydrophobic N-terminal domain of 167 amino acids and a conserved C-terminal region of 299 amino acids.The latter domain is composed of alternating hydrophobic and hydrophilic segments. Structural analysis ofThe protein suggests that Annexin VII is a membrane binding protein with diverse properties, including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion. [provided by RefSeq, Jul 2008] |
Synonyms | ANX7; SNX; SYNEXIN |
Note | Immunogen Sequence Homology: Human: 100%; Goat: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.