Antibodies

View as table Download

ESRP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ESRP2

Rabbit Polyclonal Anti-RBM35B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of human RBM35B. Synthetic peptide located within the following region: ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ

Rabbit Polyclonal Anti-Esrp2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Esrp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT

Rabbit Polyclonal RBM35B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RBM35B antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human RBM35B.

Rabbit polyclonal anti-RBM35B antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of mouse RBM35B. Synthetic peptide located within the following region: EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF

ESRP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ESRP2