Germany
Japan
United Kingdom
China
Antibodies
View as table Download
FAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAS |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Rabbit anti CD95 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Fas Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-335 of human Fas (NP_000034.1). |
| Modifications | Unmodified |
Fas Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 61-335 of human Fas (NP_000034.1). |
| Modifications | Unmodified |
Phospho-Fas-Y291 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around Y291 of human FAS (NP_000034.1). |
| Modifications | Phospho Y291 |
Fas Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Fas |
Active filters
Target Symbol
- FAS
Isotypes
- IgG
Conjugates
- Unconjugated
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Modifications
Pathways
- Allograft rejection (7)
- Alzheimer's disease (7)
- Apoptosis (7)
- Autoimmune thyroid disease (7)
- Cytokine-cytokine receptor interaction (7)
- Graft-versus-host disease (7)
- MAPK signaling pathway (7)
- Natural killer cell mediated cytotoxicity (7)
- Pathways in cancer (7)
- Type I diabetes mellitus (7)
- p53 signaling pathway (7)