CD95 (FAS) Rabbit Polyclonal Antibody

CAT#: TA337864

Rabbit Polyclonal Anti-FAIM2 Antibody

Product Images

Host: Rabbit; Target Name: FAIM2; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: Fas cell surface death receptor
• Database Link:
  NP_690615
  Entrez Gene 355 Human
  UniProt ID P25445
• Background: The function of this protein remains unknown.
• Synonyms: ALPS1A; APO-1; APT1; CD95; FAS1; FASTM; TNFRSF6
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
• Protein Pathways: Allograft rejection, Alzheimer's disease, Apoptosis, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Graft-versus-host disease, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Pathways in cancer, Type I diabetes mellitus