Antibodies

View as table Download

Rabbit Polyclonal Anti-Keratin 14 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Keratin 14 Antibody: A synthesized peptide derived from human Keratin 14

Rabbit Polyclonal Anti-KRT14 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KRT14 antibody: synthetic peptide directed towards the C terminal of human KRT14. Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Rabbit anti Keratin 14 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Anti-KRT14 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 457-472 amino acids of Human Keratin, type I cytoskeletal 14

Anti-KRT14 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 457-472 amino acids of Human Keratin, type I cytoskeletal 14

Cytokeratin 14 (KRT14) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human Cytokeratin 14 (Cytokeratin 14 (KRT14)) (NP_000517.2).
Modifications Unmodified