Rabbit polyclonal anti-MEKKK 4 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEKKK 4. |
Rabbit polyclonal anti-MEKKK 4 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEKKK 4. |
Rabbit Polyclonal Anti-MEKKK 4 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MEKKK 4 Antibody: A synthesized peptide derived from human MEKKK 4 |
Rabbit polyclonal Anti-MAP4K4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4. Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ |
MAP4K4 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 480-650 of human MAP4K4 (NP_663719.2). |
Modifications | Unmodified |