Antibodies

View as table Download

RBBP4 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RBBP4

Rabbit polyclonal Anti-RBBP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBBP4 antibody: synthetic peptide directed towards the N terminal of human RBBP4. Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Rabbit polyclonal Anti-Rbbp4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rbbp4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rbbp4. Synthetic peptide located within the following region: TAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQ

RBBP4 Rabbit polyclonal Antibody

Applications ChIP, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-425 of human RBBP4 (NP_005601.1).
Modifications Unmodified

RBBP4 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human RbAp48

RBBP4 Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Hamster, Human, Mouse, Rat
Conjugation Unconjugated