Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398) |
Rabbit polyclonal anti-A-RAF antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human A-RAF. |
Rabbit Polyclonal Anti-ARAF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARAF antibody: synthetic peptide directed towards the middle region of human ARAF. Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW |
Rabbit anti Raf -A Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A Synthetic peptide derived from N-term of Raf-A conjugated to KLH |
Carrier-free (BSA/glycerol-free) Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ARAF mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
