Antibodies

View as table Download

Rabbit Polyclonal Anti-PIWIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the N terminal of human PIWIL1. Synthetic peptide located within the following region: FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR

Rabbit Polyclonal Anti-PIWIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the middle region of human PIWIL1. Synthetic peptide located within the following region: LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY

Rabbit Polyclonal PIWI-L1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIWI-L1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human PIWI-L1.

Rabbit anti-PIWIL1 polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide from the intermediate residues of human PIWIL1 protein.

Goat Anti-PIWI / HIWI Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNRKDKYDAIKKY, from the internal region of the protein sequence according to NP_004755.2; NP_001177900.1.

Anti-PIWIL1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 555-847 amino acids of human piwi-like RNA-mediated gene silencing 1

Anti-PIWIL1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 555-847 amino acids of human piwi-like RNA-mediated gene silencing 1