Rabbit anti-ARRB1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ARRB1 |
Rabbit anti-ARRB1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ARRB1 |
Rabbit Polyclonal Anti-ARRB1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARRB1 |
Rabbit polyclonal ARRB1 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ARRB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-363 amino acids from the C-terminal region of human ARRB1. |
Rabbit polyclonal Arrestin 1 (Ser412) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Arrestin-1 around the phosphorylation site of serine 412 (T-G-SP-P-Q). |
Modifications | Phospho-specific |
USD 380.00
4 Weeks
Mouse Monoclonal beta Arrestin 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ARRB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARRB1. |
Rabbit Polyclonal anti-ARRB1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARRB1 antibody: synthetic peptide directed towards the middle region of human ARRB1. Synthetic peptide located within the following region: NETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNN |
Carrier-free (BSA/glycerol-free) ARRB1 mouse monoclonal antibody, clone OTI2B3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARRB1 mouse monoclonal antibody, clone OTI3F10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ARRB1 mouse monoclonal antibody, clone OTI3G9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ARRB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ARRB1 |
ARRB1 mouse monoclonal antibody, clone OTI2B3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARRB1 mouse monoclonal antibody, clone OTI2B3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARRB1 mouse monoclonal antibody, clone OTI3F10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARRB1 mouse monoclonal antibody, clone OTI3F10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARRB1 mouse monoclonal antibody, clone OTI3G9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARRB1 mouse monoclonal antibody, clone OTI3G9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".