Antibodies

Jump to Filters
View as table Download
ETS1 Rabbit Polyclonal Antibody
TA332412

USD 380.00

3 Weeks

Rabbit anti-ETS1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human ETS1
ETS1 Rabbit Monoclonal Antibody [Clone ID: EPR546(2)]
TA307238

USD 512.00

In Stock

Rabbit monoclonal antibody against ETS1(clone EPR546(2))

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
ETS1 Rabbit Polyclonal Antibody
TA330028

USD 310.00

5 Days

Rabbit Polyclonal Anti-ETS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN
ETS1 Rabbit Polyclonal Antibody
TA323910

USD 345.00

4 Weeks

Anti-ETS1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 209 amino acids of human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
ETS1 Rabbit Polyclonal Antibody
TA329150

USD 375.00

5 Days

Rabbit Polyclonal anti-ETS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETS1 antibody is: synthetic peptide directed towards the middle region of Human ETS1. Synthetic peptide located within the following region: FQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNG