Rabbit Polyclonal antibody to PSAT1 (phosphoserine aminotransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 328 of PSAT1 (Uniprot ID#Q9Y617) |
Rabbit Polyclonal Anti-PDXP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDXP antibody is: synthetic peptide directed towards the N-terminal region of Human PDXP. Synthetic peptide located within the following region: SNNSRRARPELALRFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAP |
Rabbit Polyclonal Anti-PNPO Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPO antibody: synthetic peptide directed towards the N terminal of human PNPO. Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT |
Rabbit Polyclonal Anti-PDXP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDXP antibody: synthetic peptide directed towards the middle region of human PDXP. Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI |
Rabbit Polyclonal Anti-PSAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSAT1 antibody: synthetic peptide directed towards the N terminal of human PSAT1. Synthetic peptide located within the following region: ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY |
Rabbit Polyclonal Anti-PDXK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDXK Antibody: synthetic peptide directed towards the middle region of human PDXK. Synthetic peptide located within the following region: RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN |
Goat Anti-PDXP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QHDLVPHYYVES, from the C Terminus of the protein sequence according to NP_064711.1. |
Rabbit Polyclonal Anti-PDXK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDXK Antibody: synthetic peptide directed towards the N terminal of human PDXK. Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK |
Anti-AOX1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1 |
Germany
Japan
United Kingdom
China
