PNPO Rabbit Polyclonal Antibody

CAT#: TA344305

Rabbit Polyclonal Anti-PNPO Antibody - N-terminal region

Product Images

WB Suggested Anti-PNPO Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PNPO antibody: synthetic peptide directed towards the N terminal of human PNPO. Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: pyridoxamine 5'-phosphate oxidase
• Database Link:
  NP_060599
  Entrez Gene 55163 Human
  UniProt ID Q9NVS9
• Background: PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5). [supplied by OMIM]
• Synonyms: HEL-S-302; PDXPO
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%

Reference Data

• Protein Pathways: Metabolic pathways, Vitamin B6 metabolism