Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PNPO Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPO antibody: synthetic peptide directed towards the N terminal of human PNPO. Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT |
PNPO (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 232~261 amino acids from the C-terminal region of human PNPO |
PNPO rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PNPO |
PNPO Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PNPO. |
PNPO mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PNPO mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
| Applications | IF, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PNPO mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PNPO mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- PNPO