Antibodies

View as table Download

Rabbit polyclonal anti-STEA3 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STEA3.

STEAP3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human STEAP3

Rabbit Polyclonal Anti-STEA3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-STEA3 Antibody: A synthesized peptide derived from human STEA3

Rabbit Polyclonal STEAP3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STEAP3 antibody was raised against a 15 amino acid peptide from near the amino terminus of human STEAP3.

Rabbit Polyclonal Anti-STEAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the C terminal of human STEAP3. Synthetic peptide located within the following region: VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

Rabbit Polyclonal Anti-STEAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the N terminal of human STEAP3. Synthetic peptide located within the following region: LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY