Antibodies

View as table Download

Rabbit anti-AZGP1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AZGP1

Rabbit Polyclonal Anti-AZGP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AZGP1 antibody: synthetic peptide directed towards the N terminal of human AZGP1. Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL

Carrier-free (BSA/glycerol-free) AZGP1 mouse monoclonal antibody,clone OTI10F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AZGP1 mouse monoclonal antibody,clone OTI2H3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated