Antibodies

View as table Download

Rabbit Polyclonal FKBP51 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP51 antibody: mouse FKBP51 (FK506 Binding Protein 51), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein

Mouse monoclonal FKBP51 Antibody

Applications IF, WB
Reactivities Canine, Hamster, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-FKBP5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP5 antibody: synthetic peptide directed towards the C terminal of human FKBP5. Synthetic peptide located within the following region: CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Rabbit Polyclonal Anti-FKBP5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP5 antibody is: synthetic peptide directed towards the middle region of Human FKBP5. Synthetic peptide located within the following region: KMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESW

Carrier-free (BSA/glycerol-free) FKBP5 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FKBP51/FKBP5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 308-457 of human FKBP51/FKBP51/FKBP51/FKBP5 (NP_001139247.1).
Modifications Unmodified

Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FKBP5 (FKBP51) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated