Antibodies

View as table Download

CRP Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CRP

Rabbit Polyclonal Anti-CRP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRP antibody: synthetic peptide directed towards the N terminal of human CRP. Synthetic peptide located within the following region: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

C Reactive Protein (CRP) mouse monoclonal antibody, clone N1G1, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti CRP (IN) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human CRP protein (from 32aa-41aa). This sequence is identical to human and mouse.

Rabbit anti CRP (NT) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human CRP protein (from 42aa-49aa).

Rabbit anti CRP (NT) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human CRP protein (from 67aa-75aa). This sequence is identical to human, mouse and rat.

Anti-CRP Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-91 amino acids of human C-reactive protein, pentraxin-related

Anti-CRP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-91 amino acids of human C-reactive protein, pentraxin-related

C-Reactive Protein (CRP) Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human C-Reactive Protein (C-Reactive Protein (CRP))
Modifications Unmodified