Rabbit polyclonal KLF6 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 159-186 amino acids from the C-terminal region of human KLF6. |
KLF6 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KLF6 |
Rabbit Polyclonal Anti-KLF6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF6 antibody: synthetic peptide directed towards the middle region of human KLF6. Synthetic peptide located within the following region: SREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHF |
Rabbit Polyclonal Anti-KLF6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF6 antibody: synthetic peptide directed towards the N terminal of human KLF6. Synthetic peptide located within the following region: REKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS |
KLF6 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse KLF6 |
KLF6 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human KLF6 (NP_001291.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
